PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G010400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 979aa    MW: 108393 Da    PI: 6.7461
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G010400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.62.6e-41158235178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqve+C adls+ak+yhrrhkvC+ hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Manes.05G010400.1.p 158 VCQVEDCGADLSNAKDYHRRHKVCDLHSKASKALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTNP 235
                          6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.9E-33152220IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.146156233IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-38157237IPR004333Transcription factor, SBP-box
PfamPF031102.4E-29159232IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.204.6E-6755864IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484034.51E-7755860IPR020683Ankyrin repeat-containing domain
CDDcd002045.14E-7756863No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 979 aa     Download sequence    Send to blast
MEARFGGEGE AQAHHFCGMS ATEMRAVGKR SLEWDLNDWK WDGDLFIASP LNPVPSGGMG  60
RQFFPVATGI PVNGNSSNSS SSCSDEVNLG IEQGKRELEK RRRVIVIEDD NLNGEEVGSL  120
SLKLGGHGYP ITQREIRSWE GNSGKKTKLA GGSMSRAVCQ VEDCGADLSN AKDYHRRHKV  180
CDLHSKASKA LVGNVMQRFC QQCSRFHVLQ EFDEGKRSCR RRLAGHNKRR RKTNPEAAGN  240
GSSLNDDQTT SYLLISLLRI LSNMHSNRSD QVTDQDLLSH LLKSLGSHTI EHGGRNISGL  300
LQESRDLLND GNSEQVGHAH GANGANMQTS PVKPSILNNY PAYSEVRDTT VGQVKMNNFD  360
LNDIYVDSDD GAEDIERSPV VTNMMTSSLD CPSWIQQDSH QSSPPQTSRN SDSASAQSPS  420
SSSGDAQSRT DRIIFKLFGK EPNDFPLALR AQILDWLSHS PTDIESYIRP GCVILTIYLR  480
QADATWEELC CNLSSSLGRL LDVSDDAFWR TGWVYIKVQH QVAFVCNGKV VVDTSLSLKS  540
NNCSQILSVK PIAISASEKA QFVIKGINLS RPTTRLLCAV EGKYMFQKDT EELMGRVDNL  600
KGHKELQCVN FSCSIPTVSG RGFIEIEDHG FSSSYFPFIV AEDDVCSDIR MLEGVLEFAE  660
TDADGSGKMV AKNQAMEFIH EIGWLLHRSQ LKSRLDHLDP YTDLFPLKRF KWLMEFSMDH  720
EWCAVVKKLL NILLKGVVGT GEHSSLDLAL SEMGLLHRAV RKNSRSLVEL LLRYAPEKTV  780
PENKLLIGGS HESSLFRPDA TGPAGLTPLH IAAGKDGSED VLDVLTDDPG MVGIEAWKSA  840
RDSTGFTPED YARLRGHYLY IHLVQKKINK RSAVGHVVLD IPEALSDCST KQKQNEEVST  900
SFEIAQTAKR PIQRPCKLCH QKLDYGTAGR SLLYRPAMLS MVAIAAVCVC VALLFKSSPE  960
VVYVFRPFRW ELLDYGTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-30150232284squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199103KRRRV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012082979.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A067K9350.0A0A067K935_JATCU; Uncharacterized protein
STRINGPOPTR_0002s18970.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1